ELISA Recombinant Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:Q5ZIS0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SHGGAPQGHGSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGL GQVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAmLWSI Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cytochrome b small subu Gene Names:Name:SDHD ORF Names:RCJMB04_23p7 Expression Region:46-157 Sequence Info:fµLl length protein