ELISA Recombinant Transmembrane protein 240(TMEM240)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q5SV17 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHY VIPYDGDQSVVDASENYFVTDSVTKQEIDLmLGLLLGFCISWFLVWMDGVLHCAVRAWRA GRRYDGSWTWLPKLCSLRELGRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHL Protein Names:Recommended name: Transmembrane protein 240 Gene Names:Name:TMEM240 Synonyms:C1orf70 Expression Region:1-173 Sequence Info:fµLl length protein