ELISA Recombinant UPF0414 transmembrane protein C20orf30 homolog(RCJMB04_6c24)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:Q5ZLH4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMPSRTNLSAGIPSSKVKYSKLASTDDGYIDLQFKKSPPKIPYKAIALAVVLFMIGTFLI IIGALLLAGYISKGGTDRAIPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD Protein Names:Recommended name: UPF0414 transmembrane protein C20orf30 homolog Gene Names:ORF Names:RCJMB04_6c24 Expression Region:1-120 Sequence Info:fµLl length protein