ELISA Recombinant Transmembrane 4 L6 family member 20(TM4SF20)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q53R12 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGL MAIPATTMSLTARKRACCNNRTGMFLSSLFSVITVIGALYCmLISIQALLKGPLMCNSPS NSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSE ENKHRLIHFSVFLGLLLVGILEVLFGLSQIVIGFLGCLCGVSKRRSQIV Protein Names:Recommended name: Transmembrane 4 L6 family member 20 Gene Names:Name:TM4SF20 ORF Names:UNQ518/PRO994 Expression Region:1-229 Sequence Info:fµLl length protein