Skip to Content

ELISA Recombinant Flagellar biosynthetic protein flhB(flhB)

https://www.scicommhub.com/web/image/product.template/112954/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia enterocolitica Uniprot NO.:Q56886 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEDSDADKSEEPTAHKLEKAREKGQIPRSRELTSmLmLGAGLAILWVSGESMARQLAAM IAQGLHFDHGLISDDKQmLRQIGmLLRQTLIGLIPIFAGLVIVAMAVPmLLGGVLFSGES IKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAPPV AALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDPHV KGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVALR IRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLI PKKPEHLPVPEGLDFATEESETD Protein Names:Recommended name: Flagellar biosynthetic protein flhB Gene Names:Name:flhB Expression Region:1-383 Sequence Info:fµLl length protein

1,739.00 € 1739.0 EUR 1,739.00 €

1,739.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF701104YAQ

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.