ELISA Recombinant FIT family protein ZK265.9(ZK265.9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Caenorhabditis elegans Uniprot NO.:Q5CZ37 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTRRSSTRADSTTKRPASPNSTPNAALGIFVAIARQILFIDARKVALFYLAFVTVLSFI ESRIELDSTYYLVQKHSVLNQYGVKMGWFWTLVIVGPFIWFSSKAHNRRDRDQPIVDVCR LGVGTACWYFSVQFFHKVLALTSMCDKGRTLTRAQCSEKEGVWTPGYDISGHCFLMIYSI LIITEEAIAYRHYQQVTDAVHQMDGDREEHDRLTRCIQYFFVAmLFLHAFWFKQIIISVL YYHIFIEEILGAVAAVVCWFVTYRmLYPAGFLASPIRRTVGRK Protein Names:Recommended name: FIT family protein ZK265.9 Gene Names:ORF Names:ZK265.9 Expression Region:1-283 Sequence Info:fµLl length protein