ELISA Recombinant Feline coronavirus Envelope small membrane protein(E)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)
Uniprot NO.:Q52PA5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTFPRAFTIIDDHGMVVSVFFWLLLIIILILFSIALLNVIKLCMVCCNLGKTIIVLPARH AYDAYKTFMQTKAYNPDEAFLV
Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein
Gene Names:Name:E Synonyms:sM
Expression Region:1-82
Sequence Info:fµLl length protein