Skip to Content

ELISA Recombinant Fatty acid desaturase(desA)

https://www.scicommhub.com/web/image/product.template/112944/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:SpirµLina platensis Uniprot NO.:Q54794 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLSIVKSEDSSSRPSAVPSDLPLEEDIINTLPSGVFVQDRYKAWMTVIINVVMVGLGWL GIAIAPWFLLPVVWVFTGTALTGFFVIGHDCGHRSFSRNVWVNDWVGHILFLPIIYPFHS WRIGHNQHHKYTNRMELDNAWQPWRKEEYQNAGKFMQVTYDLFRGRAWWIGSILHWASIH FDWTKFEGKQRQQVKFSSLLVIGAAAIAFPTMILTIGVWGFVKFWVIPWLVFHFWMSTFT LLHHTIADIPFREPEQWHEAESQLSGTVHCNYSRWGEFLCHDINVHIPHHVTTAIPWYNL RTPTPVYRKIGGEYLYPECDFSWGLMKQVVDHAICMMRITIISQSLTTKRV Protein Names:Recommended name: Fatty acid desaturase EC= 1.14.19.- Alternative name(s): Delta(12)-desaturase Gene Names:Name:desA Expression Region:1-351 Sequence Info:fµLl length protein

1,705.00 € 1705.0 EUR 1,705.00 €

1,705.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days