ELISA Recombinant Uncharacterized protein C12orf59(C12orf59)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q4KMG9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:EENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGLTSLCFRCCCLSRQQNGEDGGPPPC EVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEEALHM SRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN Protein Names:Recommended name: Uncharacterized protein C12orf59 Gene Names:Name:C12orf59 ORF Names:UNQ5927/PRO19821 Expression Region:25-183 Sequence Info:fµLl length protein