ELISA Recombinant Escherichia coli Protein sirB2(sirB2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:Q46755 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSFSTLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALM AKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIK LATTKVPLLG Protein Names:Recommended name: Protein sirB2 Gene Names:Name:sirB2 Synonyms:ychQ Ordered Locus Names:b1213, JW1204 Expression Region:1-130 Sequence Info:fµLl length protein