ELISA Recombinant Escherichia coli Protein sirB2(sirB2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:Q46755
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSFSTLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALM AKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIK LATTKVPLLG
Protein Names:Recommended name: Protein sirB2
Gene Names:Name:sirB2 Synonyms:ychQ Ordered Locus Names:b1213, JW1204
Expression Region:1-130
Sequence Info:fµLl length protein