ELISA Recombinant Eucalyptus globulus subsp. globulus ATP synthase subunit a, chloroplastic(atpI)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Eucalyptus globµLus subsp. globµLus (Tasmanian blue gum)
Uniprot NO.:Q49L10
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVLSCSTNTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSASIAVRN PQTIPNDSQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLSYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Protein Names:Recommended name: ATP synthase subunit a, chloroplastic Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit IV
Gene Names:Name:atpI
Expression Region:1-247
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF673241EHL
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.