Skip to Content

ELISA Recombinant Tetraspanin-31(TSPAN31)

https://www.scicommhub.com/web/image/product.template/149716/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q29257 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVCGGFACSKNALCALNVVYmLVGLLLIGVAAWAKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFGISCSCLAINLSKQAGIIN Protein Names:Recommended name: Tetraspanin-31 Short name= Tspan-31 Alternative name(s): Sarcoma-amplified sequence homolog Gene Names:Name:TSPAN31 Synonyms:SAS Expression Region:1-109 Sequence Info:fµLl length protein

1,450.00 € 1450.0 EUR 1,450.00 €

1,450.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF644910PI

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.