ELISA Recombinant Escherichia coli UPF0208 membrane protein YfbV(yfbV)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain UTI89 / UPEC) Uniprot NO.:Q1R9C0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTCYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYDVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL Protein Names:Recommended name: UPF0208 membrane protein YfbV Gene Names:Name:yfbV Ordered Locus Names:UTI89_C2577 Expression Region:1-151 Sequence Info:fµLl length protein