ELISA Recombinant Escherichia coli sn-glycerol-3-phosphate transport system permease protein ugpE(ugpE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain UTI89 / UPEC) Uniprot NO.:Q1R5H7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIENRPWLTIFSHTmLILGIAVILFPLYVAFVAATLDKQEVYAAPMTLIPGTHLLENIHN IWVNGVGTNSAPFWRmLLNSFVMAFSITLGKITVSmLSAFAIVWFRFPLRNLFFWMIFIT LmLPVEVRIFPTVEVIANLKmLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT GEGTTEWNSVMAAmLLTLIPPVVIVLVMQRAFVRGLVDSEK Protein Names:Recommended name: sn-glycerol-3-phosphate transport system permease protein µgpE Gene Names:Name:µgpE Ordered Locus Names:UTI89_C3958 Expression Region:1-281 Sequence Info:fµLl length protein