ELISA Recombinant Escherichia coli Universal stress protein B(uspB)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain UTI89 / UPEC)
Uniprot NO.:Q1R5C2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Protein Names:Recommended name: Universal stress protein B
Gene Names:Name:uspB Ordered Locus Names:UTI89_C4013
Expression Region:1-111
Sequence Info:fµLl length protein