ELISA Recombinant Escherichia coli O6:K15:H31 Protoheme IX farnesyltransferase(cyoE)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Uniprot NO.:Q0TKL4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYI DRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFmLLWFGANPLACWLGVMGFVVY VGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAAILLAIFSLWQMPHSYAI AIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLmLSLGGYAGYKYLVVAAAV SVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSVDFMVPDSHTLLAAVW
Protein Names:Recommended name: Protoheme IX farnesyltransferase EC= 2.5.1.- Alternative name(s): Heme B farnesyltransferase Heme O synthase
Gene Names:Name:cyoE Ordered Locus Names:ECP_0488
Expression Region:1-296
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.