ELISA Recombinant Escherichia coli O6:K15:H31 UPF0756 membrane protein YeaL(yeaL)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Uniprot NO.:Q0TH40
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEKQGLSIGIIILTI GVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGT VLGVALFRGVPVGPLIAAGLVSLIVGKQ
Protein Names:Recommended name: UPF0756 membrane protein YeaL
Gene Names:Name:yeaL Ordered Locus Names:ECP_1736
Expression Region:1-148
Sequence Info:fµLl length protein