ELISA Recombinant Escherichia coli O6:K15:H31 Uncharacterized protein yjiK(yjiK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O6:K15:H31 (strain 536 / UPEC) Uniprot NO.:Q0T8X4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTKSISLSKRIFVIVILFVIVAVCTFFVQSCARKSNHAASFQNYHATIDGKEIAGITNNI SSLTWSAQSNTLFSTINKPAAIVEMTTNGDLIRTIPLDFVKDLETIEYIGDNQFVISDER DYAIYVISLTPNSEVKILKKIKIPLQESPTNCGFEGLAYSRQDHTFWFFKEKNPIEVYKV NGLLSSNELHISKDKALQRQFTLDDVSGAEFNQQKNTLLVLSHESRALQEVTLVGEVIGE MSLTKGSRGLSHNIKQAEGVAMDASGNLYIVSEPNRFYRFTPQSSH Protein Names:Recommended name: Uncharacterized protein yjiK Gene Names:Name:yjiK Ordered Locus Names:ECP_4669 Expression Region:1-286 Sequence Info:fµLl length protein