ELISA Recombinant Escherichia coli O6:K15:H31 Spermidine export protein MdtI(mdtI)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O6:K15:H31 (strain 536 / UPEC) Uniprot NO.:Q0THM9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRCKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA Protein Names:Recommended name: Spermidine export protein MdtI Gene Names:Name:mdtI Ordered Locus Names:ECP_1543 Expression Region:1-109 Sequence Info:fµLl length protein