ELISA Recombinant Escherichia coli O6:K15:H31 Leucine efflux protein(leuE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O6:K15:H31 (strain 536 / UPEC) Uniprot NO.:Q0TH31 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL AWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSETKSDEPQYGAIFKRA LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQ YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS Protein Names:Recommended name: Leucine efflux protein Gene Names:Name:leuE Ordered Locus Names:ECP_1745 Expression Region:1-212 Sequence Info:fµLl length protein