Skip to Content

ELISA Recombinant Escherichia coli UPF0114 protein YqhA(yqhA)

https://www.scicommhub.com/web/image/product.template/126351/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12 / DH10B) Uniprot NO.:B1XFF6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH Protein Names:Recommended name: UPF0114 protein YqhA Gene Names:Name:yqhA Ordered Locus Names:ECDH10B_3179 Expression Region:1-164 Sequence Info:fµLl length protein

1,508.00 € 1508.0 EUR 1,508.00 €

1,508.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days