ELISA Recombinant Escherichia coli Spermidine export protein MdtJ(mdtJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12 / DH10B) Uniprot NO.:B1XF65 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILmLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V Protein Names:Recommended name: Spermidine export protein MdtJ Gene Names:Name:mdtJ Ordered Locus Names:ECDH10B_1733 Expression Region:1-121 Sequence Info:fµLl length protein