ELISA Recombinant Escherichia coli UPF0442 protein yjjB(yjjB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) Uniprot NO.:B1IS55 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVIEFLFALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE WSTFMASmLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV Protein Names:Recommended name: UPF0442 protein yjjB Gene Names:Name:yjjB Ordered Locus Names:EcolC_3692 Expression Region:1-157 Sequence Info:fµLl length protein