Skip to Content

ELISA Recombinant Finegoldia magna Glycerol-3-phosphate acyltransferase(plsY)

https://www.scicommhub.com/web/image/product.template/127434/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Finegoldia magna (strain ATCC 29328) (Peptostreptococcus magnus) Uniprot NO.:B0S1N1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNYLYLIILGIVCYFIGNISGSIAISKLVYKQDIRNYGSKNAGATNALRVYGVKVGLATF LIDFFKGLLCAYLGFKFYGSLGILVCGLLCVIGHILPVLYNFKGGKGIATSFGVLLFAQP LQVLILLILFLIVVLMTKYVSLGSVLGCISAVIYGLIYIRKDFYIGLIYILLGIISLFKH RSNINRLIHGKESKLGKN Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati Gene Names:Name:plsY Ordered Locus Names:FMG_0853 Expression Region:1-198 Sequence Info:fµLl length protein

1,544.00 € 1544.0 EUR 1,544.00 €

1,544.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF536100FES

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.