ELISA Recombinant Finegoldia magna Glycerol-3-phosphate acyltransferase(plsY)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Finegoldia magna (strain ATCC 29328) (Peptostreptococcus magnus)
Uniprot NO.:B0S1N1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNYLYLIILGIVCYFIGNISGSIAISKLVYKQDIRNYGSKNAGATNALRVYGVKVGLATF LIDFFKGLLCAYLGFKFYGSLGILVCGLLCVIGHILPVLYNFKGGKGIATSFGVLLFAQP LQVLILLILFLIVVLMTKYVSLGSVLGCISAVIYGLIYIRKDFYIGLIYILLGIISLFKH RSNINRLIHGKESKLGKN
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:FMG_0853
Expression Region:1-198
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF536100FES
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.