Skip to Content

ELISA Recombinant Francisella philomiragia subsp. philomiragia Protein CrcB homolog(crcB)

https://www.scicommhub.com/web/image/product.template/127476/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Francisella philomiragia subsp. philomiragia (strain ATCC 25017) Uniprot NO.:B0TW03 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLLLILVGIGGGLGAMSRFALTQATASISKQIPIGILLCNIIGSLIIGMMAAFLIQTKL FNEDISTYVRSLFVTGFLGGFTTFSSFSLDILNLLQRGEALLAISYILVSVIVSLIAVIL GFYFIMGIYR Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:Fphi_0690 Expression Region:1-130 Sequence Info:fµLl length protein

1,472.00 € 1472.0 EUR 1,472.00 €

1,472.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days