ELISA Recombinant Francisella philomiragia subsp. philomiragia Protein CrcB homolog(crcB)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Francisella philomiragia subsp. philomiragia (strain ATCC 25017)
Uniprot NO.:B0TW03
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLLLILVGIGGGLGAMSRFALTQATASISKQIPIGILLCNIIGSLIIGMMAAFLIQTKL FNEDISTYVRSLFVTGFLGGFTTFSSFSLDILNLLQRGEALLAISYILVSVIVSLIAVIL GFYFIMGIYR
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Fphi_0690
Expression Region:1-130
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.