Skip to Content

ELISA Recombinant Testis-specific protein TEX28(TEX28)

https://www.scicommhub.com/web/image/product.template/129110/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O15482 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDSVRHRILYLSE QLRVEKASRDGNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASATIAQIEHRLHQCHQQL QELEEGCRPEGLLLMAESDPANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFILESRF QSLQQGTCLETEDVAQQQNLLLQKVKAELEEAKRFHISLQESYHSLKERSLTDLQLLLES LQEEKCRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERMAYLSYERAKEIWEITETFKS RISKLEmLQQVTQLEAAEHLQSRPPQmLFKFLSPRLSLATVLLVFVSTLCACPSSLISSR LCTCTmLmLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYSKDSGPPADGP Protein Names:Recommended name: Testis-specific protein TEX28 Gene Names:Name:TEX28 Synonyms:CXorf2 ANDName: TEX28P1AND Name:TEX28P2 Expression Region:1-410 Sequence Info:fµLl length protein

1,768.00 € 1768.0 EUR 1,768.00 €

1,768.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.