ELISA Recombinant Fluoroquinolones export permease protein Rv2687c-MT2761 (Rv2687c, MT2761)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mycobacterium tubercµLosis Uniprot NO.:O07189 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGF FFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLL PLVAGIVLGTLLmLLVGFSSSLPFASVTDWFLAAVIPLAImLAPPVVHYSGLWPNPVLYL IPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL Protein Names:Recommended name: Fluoroquinolones export permease protein Rv2687c/MT2761 Gene Names:Ordered Locus Names:Rv2687c, MT2761 Expression Region:1-237 Sequence Info:fµLl length protein