ELISA Recombinant Fluoroquinolones export permease protein Rv2687c-MT2761 (Rv2687c, MT2761)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Mycobacterium tubercµLosis
Uniprot NO.:O07189
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGF FFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLL PLVAGIVLGTLLmLLVGFSSSLPFASVTDWFLAAVIPLAImLAPPVVHYSGLWPNPVLYL IPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL
Protein Names:Recommended name: Fluoroquinolones export permease protein Rv2687c/MT2761
Gene Names:Ordered Locus Names:Rv2687c, MT2761
Expression Region:1-237
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.