Skip to Content

ELISA Recombinant Escherichia coli Glycerol-3-phosphate acyltransferase(plsY)

https://www.scicommhub.com/web/image/product.template/125782/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12 / MC4100 / BW2952) Uniprot NO.:C4ZQX6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGmLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSmLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): G3P acyltransferase Short name= GPAT EC= 2.3.1.15 EC= 2.3.1.n5 Lysophosphatidic acid synthase Short name= LPA synthase Gene Names:Name:plsY Synonyms:ygiH Ordered Locus Names:BWG_2770 Expression Region:1-205 Sequence Info:fµLl length protein

1,551.00 € 1551.0 EUR 1,551.00 €

1,551.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF511483ENU

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.