ELISA Recombinant Exiguobacterium sp. UPF0316 protein EAT1b_0871 (EAT1b_0871)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Uniprot NO.:C4L5I5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGQILLILLLQLIYVPVLTLRTImLVKGKTVIAGLFGTLETLIYIFALGIVFQDLTTVGM IVYAVGFGLGILLGGFVERKLAIGYNMIQVHTKEYPAELIQQMRDNGYGVTHYQGQGRDG VRYRLDVLAARTRMKELRELVEKHEPKAFLVAFDPIDFKGGYMMKGLRRPK
Protein Names:Recommended name: UPF0316 protein EAT1b_0871
Gene Names:Ordered Locus Names:EAT1b_0871
Expression Region:1-171
Sequence Info:fµLl length protein