ELISA Recombinant Exiguobacterium sp. UPF0756 membrane protein EAT1b_0668 (EAT1b_0668)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) Uniprot NO.:C4L477 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAYLFLLmLVLIGVISNNQSVIIASSVLLIIKAIGFGDQLFPTLASKGISWGVTIITIA VLVPIATGDIGFKELWNSIKGPVGIVAFASGMFVAIAAGQGVQLMRVDPVVTTALLAGTI LAVGFMKGIPVGPLVGAGIAALILGGYQVIEKWF Protein Names:Recommended name: UPF0756 membrane protein EAT1b_0668 Gene Names:Ordered Locus Names:EAT1b_0668 Expression Region:1-154 Sequence Info:fµLl length protein