Skip to Content

ELISA Recombinant Exiguobacterium sp. UPF0397 protein EAT1b_2102 (EAT1b_2102)

https://www.scicommhub.com/web/image/product.template/127407/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) Uniprot NO.:C4L1J3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSFTTKQIVATGIGAAVFIILSRFAAIPTGVPNTSIETAYAFLAFMAVLFGPITAGLIG LIGHALKDAILYGSPWWSWVIVSGFVGLGIGLIANRIRLEEGGLTTKKIILFNATQAVVQ AIGWIVIAPVLDILIYAEPANKVFVQGAVAATSNILTVGVIGTLLLVTYAKTRSQAGSLK REA Protein Names:Recommended name: UPF0397 protein EAT1b_2102 Gene Names:Ordered Locus Names:EAT1b_2102 Expression Region:1-183 Sequence Info:fµLl length protein

1,528.00 € 1528.0 EUR 1,528.00 €

1,528.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF504665EPU

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.