ELISA Recombinant Exiguobacterium sp. UPF0397 protein EAT1b_2102 (EAT1b_2102)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Uniprot NO.:C4L1J3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNSFTTKQIVATGIGAAVFIILSRFAAIPTGVPNTSIETAYAFLAFMAVLFGPITAGLIG LIGHALKDAILYGSPWWSWVIVSGFVGLGIGLIANRIRLEEGGLTTKKIILFNATQAVVQ AIGWIVIAPVLDILIYAEPANKVFVQGAVAATSNILTVGVIGTLLLVTYAKTRSQAGSLK REA
Protein Names:Recommended name: UPF0397 protein EAT1b_2102
Gene Names:Ordered Locus Names:EAT1b_2102
Expression Region:1-183
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF504665EPU
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.