ELISA Recombinant Exiguobacterium sp. Large-conductance mechanosensitive channel(mscL)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Uniprot NO.:C4KYQ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWKEFKKFAMRGNVIDLAVAVVLGAAFTAIVNSLVNDIFMPLLGIIIGGIDFSSLKASIL GVDVLYGNFIQQIVSFFLIAIALFLIVKVINRLQREKEVEEAAIPTPTKEEQLLTEIRDL LKDRSL
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:EAT1b_1294
Expression Region:1-126
Sequence Info:fµLl length protein