ELISA Recombinant Escherichia coli O7:K1 Spermidine export protein MdtI(mdtI)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Uniprot NO.:B7NUP0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Protein Names:Recommended name: Spermidine export protein MdtI
Gene Names:Name:mdtI Ordered Locus Names:ECIAI39_1459
Expression Region:1-109
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF488105EON
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.