Skip to Content

ELISA Recombinant Escherichia coli O81 UPF0059 membrane protein yebN(yebN)

https://www.scicommhub.com/web/image/product.template/127128/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O81 (strain ED1a) Uniprot NO.:B7MVV0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGmL ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG Protein Names:Recommended name: UPF0059 membrane protein yebN Gene Names:Name:yebN Ordered Locus Names:ECED1_2024 Expression Region:1-188 Sequence Info:fµLl length protein

1,533.00 € 1533.0 EUR 1,533.00 €

1,533.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days