Skip to Content

ELISA Recombinant Escherichia coli O45:K1 Sulfoxide reductase heme-binding subunit YedZ(yedZ)

https://www.scicommhub.com/web/image/product.template/126899/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O45:K1 (strain S88 / ExPEC) Uniprot NO.:B7MCM5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLTAKQVTWLKVCLHLAGLLPFLWLAWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLLSLFNQLRKQVHNKLSL Protein Names:Recommended name: SµLfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ Gene Names:Name:yedZ Ordered Locus Names:ECS88_2024 Expression Region:1-211 Sequence Info:fµLl length protein

1,558.00 € 1558.0 EUR 1,558.00 €

1,558.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF487750EOK

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.