ELISA Recombinant Escherichia coli O7:K1 Probable intracellular septation protein A(yciB)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Uniprot NO.:B7NVM4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRmLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Protein Names:Recommended name: Probable intracellµLar septation protein A
Gene Names:Name:yciB Ordered Locus Names:ECIAI39_1591
Expression Region:1-179
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF487267EON
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.