ELISA Recombinant Escherichia coli O17:K52:H18 Protein psiE(psiE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) Uniprot NO.:B7NFX5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSLSRPCVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL LVITLWLCNSKRLKRE Protein Names:Recommended name: Protein psiE Gene Names:Name:psiE Ordered Locus Names:ECUMN_4565 Expression Region:1-136 Sequence Info:fµLl length protein