ELISA Recombinant Escherichia fergusonii Sulfoxide reductase heme-binding subunit YedZ(yedZ)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Uniprot NO.:B7LRM9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRLTAKQVIWLKVCLHLAGFLPFVWLAWAINHGGLSADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALFGQELITRPYLTL GIVSWLILLALAFTSTQAMQRNLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPILYA GLALLLLALRYKKFRTWLK
Protein Names:Recommended name: SµLfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ
Gene Names:Name:yedZ Ordered Locus Names:EFER_3233
Expression Region:1-199
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.