Skip to Content

ELISA Recombinant Escherichia coli O17:K52:H18 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC)

https://www.scicommhub.com/web/image/product.template/126854/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) Uniprot NO.:B7N5L9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFEIHPVKKVSVVIPVYNEQESLPELIRRTTKACESLGKEYEILLIDDGSSDNSAHmLVE ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCmLRAYRRHIVDAmLHCHER STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRmLSLLG SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFmLFAVLFTFIGAQFIGMGLLGEYIGRIYT DVRARPRYFVQQVIRPSSKENE Protein Names:Recommended name: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase EC= 2.7.8.30 Alternative name(s): Undecaprenyl-phosphate Ara4FN transferase Short name= Ara4FN transferase Gene Names:Name:arnC Ordered Locus Names:ECUMN_2595 Expression Region:1-322 Sequence Info:fµLl length protein

1,675.00 € 1675.0 EUR 1,675.00 €

1,675.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF486245EOG

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.