ELISA Recombinant Escherichia coli O45:K1 Probable intracellular septation protein A(yciB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O45:K1 (strain S88 / ExPEC) Uniprot NO.:B7mL07 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRmLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Name:yciB Ordered Locus Names:ECS88_1324 Expression Region:1-179 Sequence Info:fµLl length protein