Skip to Content

ELISA Recombinant Escherichia coli O8 4-hydroxybenzoate octaprenyltransferase(ubiA)

https://www.scicommhub.com/web/image/product.template/127043/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O8 (strain IAI1) Uniprot NO.:B7M7V3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSIVVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF Protein Names:Recommended name: 4-hydroxybenzoate octaprenyltransferase EC= 2.5.1.- Alternative name(s): 4-HB polyprenyltransferase Gene Names:Name:ubiA Ordered Locus Names:ECIAI1_4270 Expression Region:1-290 Sequence Info:fµLl length protein

1,641.00 € 1641.0 EUR 1,641.00 €

1,641.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF486016EOO

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.