ELISA Recombinant Escherichia coli UPF0060 membrane protein ynfA(ynfA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain 55989 / EAEC)
Uniprot NO.:B7L5D4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGmLIIVAGWGRT
Protein Names:Recommended name: UPF0060 membrane protein ynfA
Gene Names:Name:ynfA Ordered Locus Names:EC55989_1747
Expression Region:1-108
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.