ELISA Recombinant Escherichia coli O127:H6 UPF0442 protein yjjB(yjjB)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Uniprot NO.:B7UQZ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE WSTFMASmLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
Protein Names:Recommended name: UPF0442 protein yjjB
Gene Names:Name:yjjB Ordered Locus Names:E2348C_4662
Expression Region:1-157
Sequence Info:fµLl length protein