Skip to Content

ELISA Recombinant Escherichia coli O81 Zinc transporter ZupT(zupT)

https://www.scicommhub.com/web/image/product.template/127135/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O81 (strain ED1a) Uniprot NO.:B7N0I9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGImLLISLMEmLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRmLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTVGIG Protein Names:Recommended name: Zinc transporter ZupT Gene Names:Name:zupT Ordered Locus Names:ECED1_3708 Expression Region:1-257 Sequence Info:fµLl length protein

1,606.00 € 1606.0 EUR 1,606.00 €

1,606.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF485360EOP

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.