Skip to Content

ELISA Recombinant Escherichia fergusonii ATP synthase subunit c(atpE)

https://www.scicommhub.com/web/image/product.template/127306/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) Uniprot NO.:B7LK82 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpE Ordered Locus Names:EFER_4036 Expression Region:1-79 Sequence Info:fµLl length protein

1,418.00 € 1418.0 EUR 1,418.00 €

1,418.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF485011EOR

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.