Skip to Content

ELISA Recombinant Escherichia coli O8 UPF0060 membrane protein ynfA(ynfA)

https://www.scicommhub.com/web/image/product.template/127080/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O8 (strain IAI1) Uniprot NO.:B7LZX4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGmLIIVAGWGRT Protein Names:Recommended name: UPF0060 membrane protein ynfA Gene Names:Name:ynfA Ordered Locus Names:ECIAI1_1632 Expression Region:1-108 Sequence Info:fµLl length protein

1,449.00 € 1449.0 EUR 1,449.00 €

1,449.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days