ELISA Recombinant Escherichia fergusonii Ferrous-iron efflux pump FieF(fieF)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Uniprot NO.:B7LVD0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVV RYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMNDPGVGIIV TIVALVCTILLVSFQRWVVRRTQSQAVRADmLHYQSDVMMNGAILLALALSWYGWHSADA LFALGIGIYILYSALRMGYEAVQSLLDRALPDDERQEIIDIVTSWPGVSGAHDLRTRQSG PTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVVPREGKRFELS
Protein Names:Recommended name: Ferrous-iron efflux pump FieF
Gene Names:Name:fieF Ordered Locus Names:EFER_3858
Expression Region:1-300
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.