ELISA Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfE(rnfE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O7:K1 (strain IAI39 / ExPEC) Uniprot NO.:B7NU01 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQmLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRLEIFHTD SPFLLAmLPPSAFIGLGLmLAGKYLIDERMKKRRAEAAAERALPNGETGNV Protein Names:Recommended name: Electron transport complex protein RnfE Gene Names:Name:rnfE Ordered Locus Names:ECIAI39_1424 Expression Region:1-231 Sequence Info:fµLl length protein