Skip to Content

ELISA Recombinant Escherichia coli O17:K52:H18 Protein CrcB homolog(crcB)

https://www.scicommhub.com/web/image/product.template/126848/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) Uniprot NO.:B7N9N0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRLGWALLNVFVNLLGSFAMTALAFWL FSASTAH Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:ECUMN_0717 Expression Region:1-127 Sequence Info:fµLl length protein

1,469.00 € 1469.0 EUR 1,469.00 €

1,469.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days