Skip to Content

ELISA Recombinant Escherichia fergusonii Probable oxaloacetate decarboxylase gamma chain(oadG)

https://www.scicommhub.com/web/image/product.template/127327/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) Uniprot NO.:B7LVP2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNAAQLLGEGFTLMFLGMGFVLGFLCLLILAIKSMSVAVNRFFPEPVAAPKPAATTAAPA DDFSRLKPVIAAAIHHHRRLNS Protein Names:Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3 Gene Names:Name:oadG Ordered Locus Names:EFER_0030 Expression Region:1-82 Sequence Info:fµLl length protein

1,422.00 € 1422.0 EUR 1,422.00 €

1,422.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.